| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Neprilysin/CD10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Neprilysin/CD10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neprilysin/CD10. This antibody reacts with human. The Neprilysin/CD10 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Neprilysin/CD10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK |
|---|
| Other Names | Atriopeptidase, CALLAmembrane metallo-endopeptidase (neutral endopeptidase, enkephalinase), CD10 antigen, CD10), CD10membrane metallo-endopeptidase variant 1, Common acute lymphocytic leukemia antigen, DKFZp686O16152, EC 3.4.24, EC 3.4.24.11, Enkephalinase, EPN, membrane metallo-endopeptidase, membrane metallo-endopeptidase variant 2, MGC126681, MGC126707, NEPmembrane metallo-endopeptidase (neutral endopeptidase, enkephalinase, CALLA, neprilysin, Neutral endopeptidase, Neutral endopeptidase 24.11, SFE, Skin fibroblast elastase |
|---|
| Gene, Accession # | MME, Gene ID: 4311 |
|---|
| Catalog # | NBP2-49050 |
|---|
| Price | |
|---|
| Order / More Info | Neprilysin/CD10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|