| Edit |   |
|---|
| Antigenic Specificity | Nephronophthisis |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nephronophthisis Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nephronophthisis. This antibody reacts with human. The Nephronophthisis Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NPHP1(nephronophthisis 1 (juvenile)) The peptide sequence was selected from the middle region of NPHP1. Peptide sequence GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG. |
|---|
| Other Names | FLJ97602, JBTS4NPH1Juvenile nephronophthisis 1 protein, nephrocystin 1, nephrocystin-1, nephronophthisis 1 (juvenile), SLSN1 |
|---|
| Gene, Accession # | NPHP1, Gene ID: 4867, Accession: O15259-4, SwissProt: O15259-4 |
|---|
| Catalog # | NBP1-59110 |
|---|
| Price | |
|---|
| Order / More Info | Nephronophthisis Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|