| Edit |   |
|---|
| Antigenic Specificity | DPY19L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DPY19L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPY19L2. This antibody reacts with human. The DPY19L2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DPY19L2(dpy-19-like 2 (C. elegans)) The peptide sequence was selected form the middle region of DPY19L2. Peptide sequence IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH. |
|---|
| Other Names | dpy-19-like 2 (C. elegans), Dpy-19-like protein 2, FLJ32949, FLJ36166, protein dpy-19 homolog 2 |
|---|
| Gene, Accession # | DPY19L2, Gene ID: 283417, Accession: Q6NUT2, SwissProt: Q6NUT2 |
|---|
| Catalog # | NBP1-62195 |
|---|
| Price | |
|---|
| Order / More Info | DPY19L2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|