| 产品详情 |
| Edit |   |
| Antigenic Specificity | DPS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DPS Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPS. This antibody reacts with human. The DPS Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: 1 |
| Immunogen | Synthetic peptides corresponding to PDSS1(prenyl (decaprenyl) diphosphate synthase, subunit 1) The peptide sequence was selected from the middle region of PDSS1. Peptide sequence GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE. |
| Other Names | All-trans-decaprenyl-diphosphate synthase subunit 1, COQ1SPS, Decaprenyl pyrophosphate synthase subunit 1, decaprenyl-diphosphate synthase subunit 1, DPS, DPS1, EC 2.5.1.91, hDPS1, MGC70953, polyprenyl pyrophosphate synthetase, prenyl (decaprenyl) diphosphate synthase, subunit 1, RP13-16H11.3, subunit 1 of decaprenyl diphosphate synthase, TPRT, TPT 1, TPTcoenzyme Q1 homolog, trans-prenyltransferase, trans-prenyltransferase (TPT), Trans-prenyltransferase 1 |
| Gene, Accession # | PDSS1, Gene ID: 23590, Accession: Q5T2R2, SwissProt: Q5T2R2 |
| Catalog # | NBP1-54645 |
| Price | |
| Order / More Info | DPS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|