| 产品详情 |
| Edit |   |
| Antigenic Specificity | RBBP4/RbAp48 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RBBP4/RbAp48 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBBP4/RbAp48. This antibody reacts with human. The RBBP4/RbAp48 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RBBP4/RbAp48 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT |
| Other Names | CAF-1 subunit C, CAF-I p48, Chromatin assembly factor 1 subunit C, Chromatin assembly factor I p48 subunit, chromatin assembly factor/CAF-1 p48 subunit, histone-binding protein RBBP4, MSI1 protein homolog, Nucleosome-remodeling factor subunit RBAP48, NURF55, RbAp48, RBBP-4, retinoblastoma binding protein 4, Retinoblastoma-binding protein 4CAF-I 48 kDa subunit, Retinoblastoma-binding protein p48 |
| Gene, Accession # | RBBP4, Gene ID: 5928 |
| Catalog # | NBP2-56286 |
| Price | |
| Order / More Info | RBBP4/RbAp48 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|