| Edit |   |
|---|
| Antigenic Specificity | MAB21L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAB21L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAB21L2. This antibody reacts with human. The MAB21L2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MAB21L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSE |
|---|
| Other Names | FLJ31103, mab-21 (C. elegans)-like 2, mab-21-like 2 (C. elegans), protein mab-21-like 2 |
|---|
| Gene, Accession # | MAB21L2, Gene ID: 10586 |
|---|
| Catalog # | NBP2-58093 |
|---|
| Price | |
|---|
| Order / More Info | MAB21L2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|