| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DLEU1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DLEU1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DLEU1. This antibody reacts with human. The DLEU1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DLEU1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSI |
|---|
| Other Names | BCMS, Deleted in lymphocytic leukemia 1, deleted in lymphocytic leukemia 1 (non-protein coding), deleted in lymphocytic leukemia, 1, DLB1, DLEU2, HBV XAg-transactivated protein 6, HBV X-transactivated gene 6 protein, LEU1LEU2, NCRNA00021, XTP6MGC22430 |
|---|
| Gene, Accession # | DLEU1, Gene ID: 10301 |
|---|
| Catalog # | NBP2-55430 |
|---|
| Price | |
|---|
| Order / More Info | DLEU1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|