| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KMT2A/MLL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KMT2A/MLL Antibody from Novus Biologicals is a rabbit polyclonal antibody to KMT2A/MLL. This antibody reacts with human. The KMT2A/MLL Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human KMT2A/MLL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKED |
|---|
| Other Names | ALL1, ALL-1MLL/GAS7, CXXC7TET1-MLL, CXXC-type zinc finger protein 7, EC 2.1.1.43, HRXFLJ11783, HTRX, HTRX1MLL-AF4 der(11) fusion protein, KMT2ACDK6/MLL fusion protein, Lysine N-methyltransferase 2A, MLL/GAS7 fusion protein, MLL/GMPS fusion protein, MLL1, MLL1A, myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog), myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), Trithorax-like protein, TRX1histone-lysine N-methyltransferase MLL, Zinc finger protein HRX |
|---|
| Gene, Accession # | KMT2A, Gene ID: 4297 |
|---|
| Catalog # | NBP2-55237 |
|---|
| Price | |
|---|
| Order / More Info | KMT2A/MLL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|