| 产品详情 |
| Edit |   |
| Antigenic Specificity | KLRG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KLRG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLRG1. This antibody reacts with human. The KLRG1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human KLRG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE |
| Other Names | 2F1, CLEC15AMAFA-LIKE, C-type lectin domain family 15 member A, C-type lectin domain family 15, member A, ITIM-containing receptor MAFA-L, killer cell lectin-like receptor subfamily G member 1, killer cell lectin-like receptor subfamily G, member 1, MAFAL, MAFA-L, MAFA-like receptor, MAFAMAFA-2F1, Mast cell function-associated antigen, mast cell function-associated antigen (ITIM-containing), MGC13600 |
| Gene, Accession # | KLRG1, Gene ID: 10219 |
| Catalog # | NBP2-57506 |
| Price | |
| Order / More Info | KLRG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|