| 产品详情 |
| Edit |   |
| Antigenic Specificity | BCKDHA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BCKDHA Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCKDHA. This antibody reacts with human, mouse. The BCKDHA Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
| Immunogen | Synthetic peptide directed towards the N terminal of human BCKDHAThe immunogen for this antibody is BCKDHA. Peptide sequence NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY. |
| Other Names | 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial, BCKDE1A, BCKDH E1-alpha, branched chain keto acid dehydrogenase E1, alpha polypeptide, branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urinedisease), Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain, EC 1.2.4.4,2-oxoisovalerate dehydrogenase (lipoamide), FLJ45695, MSU, MSUD1, OVD1A |
| Gene, Accession # | BCKDHA, Gene ID: 593, Accession: NP_000700, SwissProt: NP_000700 |
| Catalog # | NBP1-79616 |
| Price | |
| Order / More Info | BCKDHA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26571352, 30327559 |
| 产品资料 |
|
|