| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BCKDHA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BCKDHA Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCKDHA. This antibody reacts with human. The BCKDHA Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BCKDHA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH |
|---|
| Other Names | 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial, BCKDE1A, BCKDH E1-alpha, branched chain keto acid dehydrogenase E1, alpha polypeptide, branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urinedisease), Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain, EC 1.2.4.4,2-oxoisovalerate dehydrogenase (lipoamide), FLJ45695, MSU, MSUD1, OVD1A |
|---|
| Gene, Accession # | BCKDHA, Gene ID: 593, Accession: P12694 |
|---|
| Catalog # | NBP1-81022 |
|---|
| Price | |
|---|
| Order / More Info | BCKDHA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|