| 产品详情 |
| Edit |   |
| Antigenic Specificity | AMPK alpha 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AMPK alpha 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AMPK alpha 1. This antibody reacts with human. The AMPK alpha 1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human AMPK alpha 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA |
| Other Names | AMP -activate kinase alpha 1 subunit, AMP-activated protein kinase, catalytic, alpha-1,5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK, AMPK alpha 1,5'-AMP-activated protein kinase, catalytic alpha-1 chain, AMPK subunit alpha-1, AMPK1, AMPKa1, EC 2.7.11, EC 2.7.11.1, MGC33776, MGC57364, protein kinase, AMP-activated, alpha 1 catalytic subunit |
| Gene, Accession # | PRKAA1, Gene ID: 5562 |
| Catalog # | NBP2-58302 |
| Price | |
| Order / More Info | AMPK alpha 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|