| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC9A9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC9A9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC9A9. This antibody reacts with human. The SLC9A9 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC9A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAIL |
|---|
| Other Names | AUTS16, FLJ35613, Na(+)/H(+) exchanger 9, NHE9, NHE-9, putative protein product of Nbla00118, sodium/hydrogen exchanger 9, sodium/proton exchanger NHE9, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), isoform 9, solute carrier family 9 (sodium/hydrogen exchanger), member 9, Solute carrier family 9 member 9 |
|---|
| Gene, Accession # | SLC9A9, Gene ID: 285195, Accession: Q8IVB4, SwissProt: Q8IVB4 |
|---|
| Catalog # | NBP2-34102 |
|---|
| Price | |
|---|
| Order / More Info | SLC9A9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|