| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC7A2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC7A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC7A2. This antibody reacts with human. The SLC7A2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SLC7A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHE |
|---|
| Other Names | CAT2, CAT-2, cationic 2, cationic amino acid transporter, y+ system, low affinity cationic amino acid transporter 2, low-affinity cationic amino acid transporter-2, solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, Solute carrier family 7 member 2 |
|---|
| Gene, Accession # | SLC7A2, Gene ID: 6542 |
|---|
| Catalog # | NBP2-58924 |
|---|
| Price | |
|---|
| Order / More Info | SLC7A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|