| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC7A10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC7A10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC7A10. This antibody reacts with human. The SLC7A10 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RSKPKCVHRLTESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ |
|---|
| Other Names | asc-1, ASC1, asc-type amino acid transporter 1, FLJ20839, HASC-1, solute carrier family 7 (neutral amino acid transporter light chain, asc system), member 10, solute carrier family 7 member 10, solute carrier family 7, (cationic amino acid transporter, y+ system) member 10, solute carrier family 7, (neutral amino acid transporter, y+ system) member 10 |
|---|
| Gene, Accession # | SLC7A10, Gene ID: 56301 |
|---|
| Catalog # | NBP1-88814-25ul |
|---|
| Price | |
|---|
| Order / More Info | SLC7A10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|