| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FATE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot reactivity reported in (PMID: 26567849). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FATE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FATE1. This antibody reacts with human. The FATE1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FATE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATW |
|---|
| Other Names | Cancer/testis antigen 43, CT43BJ-HCC-2 antigen, FATEfetal and adult testis expressed transcript protein, fetal and adult testis expressed 1, fetal and adult testis-expressed transcript protein, Tumor antigen BJ-HCC-2 |
|---|
| Gene, Accession # | FATE1, Gene ID: 89885 |
|---|
| Catalog # | NBP1-85402 |
|---|
| Price | |
|---|
| Order / More Info | FATE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261, 24598113, 26567849 |
|---|
| 产品资料 |
|
|