| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAT4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAT4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAT4. This antibody reacts with human. The FAT4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FAT4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHT |
|---|
| Other Names | cadherin family member 14, cadherin-related family member 11, CDHR11, FAT tumor suppressor homolog 4 (Drosophila), FAT-J, fat-like cadherin protein FAT-J, FLJ77878, hFat4, Nbla00548, putative protein product of Nbla00548 |
|---|
| Gene, Accession # | FAT4, Gene ID: 79633 |
|---|
| Catalog # | NBP2-49064 |
|---|
| Price | |
|---|
| Order / More Info | FAT4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|