| 产品详情 |
| Edit |   |
| Antigenic Specificity | Tensin 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in (PMID: 25766369). Immunohistochemistry-Paraffin verified by a customer review. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Tensin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tensin 1. This antibody reacts with human, rat. The Tensin 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat Tensin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK |
| Other Names | DKFZp586K0617, matrix-remodelling associated 6, Matrix-remodelling-associated protein 6, MGC88584, MST091, MST122, MST127, MSTP127, MXRA6, tensin, tensin 1, tensin-1, TNSMSTP122 |
| Gene, Accession # | TNS1, Gene ID: 7145 |
| Catalog # | NBP1-84129 |
| Price | |
| Order / More Info | Tensin 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25766369, 29348458, 30813060 |
| 产品资料 |
|
|