| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VprBP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VprBP Antibody from Novus Biologicals is a rabbit polyclonal antibody to VprBP. This antibody reacts with human. The VprBP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human VprBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SAKQGDRENFRKAKQKLGFSSSDPDRMFVELSNSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYIDLKQTNDVLL |
|---|
| Other Names | DCAF1DDB1 and CUL4 associated factor 1, DDB1- and CUL4-associated factor 1, HIV-1 Vpr-binding protein, KIAA0800protein VPRBP, MGC102804, RIP, Vpr (HIV-1) binding protein, Vpr-binding protein, VprBP, Vpr-interacting protein |
|---|
| Gene, Accession # | VPRBP, Gene ID: 9730 |
|---|
| Catalog # | NBP2-57102 |
|---|
| Price | |
|---|
| Order / More Info | VprBP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|