| Edit |   |
|---|
| Antigenic Specificity | VP26B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VP26B Antibody from Novus Biologicals is a rabbit polyclonal antibody to VP26B. This antibody reacts with human. The VP26B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to VPS26B(vacuolar protein sorting 26 homolog B (S. pombe)) The peptide sequence was selected from the C terminal of VPS26B. Peptide sequence AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR. |
|---|
| Other Names | MGC10485, Pep8b, vacuolar protein sorting 26 homolog B (S. pombe), vacuolar protein sorting 26 homolog B (yeast), vacuolar protein sorting-associated protein 26B, Vesicle protein sorting 26B |
|---|
| Gene, Accession # | VPS26B, Gene ID: 112936, Accession: Q4G0F5, SwissProt: Q4G0F5 |
|---|
| Catalog # | NBP1-56502 |
|---|
| Price | |
|---|
| Order / More Info | VP26B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|