| 产品详情 |
| Edit |   |
| Antigenic Specificity | PHOX2A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PHOX2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PHOX2A. This antibody reacts with human. The PHOX2A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF |
| Other Names | aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive, aristaless homeobox homolog, Aristaless homeobox protein homolog, arix homeodomain protein, ARIX1 homeodomain protein, ARIXNCAM2, CFEOM2MGC52227, paired mesoderm homeobox protein 2A, paired-like homeobox 2apaired-like (aristaless) homeobox 2a, PMX2AFEOM2 |
| Gene, Accession # | PHOX2A, Gene ID: 401 |
| Catalog # | NBP2-62721 |
| Price | |
| Order / More Info | PHOX2A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|