| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UAF1/WDR48 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. Chip, IP, WB reactivity reported in (PMID: 25855980). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UAF1/WDR48 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UAF1/WDR48. This antibody reacts with human. The UAF1/WDR48 Antibody has been validated for the following applications: Western Blot, Simple Western, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat UAF1/WDR48 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF |
|---|
| Other Names | KIAA1449DKFZp686G1794, P80, UAF1, USP1 associated factor 1, USP1-associated factor 1, WD repeat domain 48, WD repeat endosomal protein, WD repeat-containing protein 48 |
|---|
| Gene, Accession # | WDR48, Gene ID: 57599, Accession: Q8TAF3, SwissProt: Q8TAF3 |
|---|
| Catalog # | NBP1-81404 |
|---|
| Price | |
|---|
| Order / More Info | UAF1/WDR48 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25855980 |
|---|
| 产品资料 |
|
|