| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | U2AF1L4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The U2AF1L4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to U2AF1L4. This antibody reacts with human. The U2AF1L4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human U2AF1L4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP |
|---|
| Other Names | FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA auxiliary factor 1-like protein 4, U2(RNU2) small nuclear RNA auxiliary factor 1-like 3, U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3, U2AF1L3, U2AF1L3V1, U2AF1-like protein 3, U2AF1RS3, U2AF1-RS3, U2af26 |
|---|
| Gene, Accession # | U2AF1L4, Gene ID: 199746 |
|---|
| Catalog # | NBP2-55898 |
|---|
| Price | |
|---|
| Order / More Info | U2AF1L4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|