| 产品详情 |
| Edit |   |
| Antigenic Specificity | U2AF2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The U2AF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to U2AF2. This antibody reacts with human. The U2AF2 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVS |
| Other Names | hU2AF(65), hU2AF65, splicing factor U2AF 65 kD subunit, splicing factor U2AF 65 kDa subunit, U2 (RNU2) small nuclear RNA auxiliary factor 2, U2 auxiliary factor 65 kDa subunit, U2 small nuclear ribonucleoprotein auxiliary factor (65kD), U2 small nuclear RNA auxiliary factor 2, U2AF65U2 snRNP auxiliary factor large subunit |
| Gene, Accession # | U2AF2, Gene ID: 11338, Accession: P26368, SwissProt: P26368 |
| Catalog # | NBP2-33397-25ul |
| Price | |
| Order / More Info | U2AF2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|