| Edit |   |
| Antigenic Specificity | R3HDM2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The R3HDM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to R3HDM2. This antibody reacts with human. The R3HDM2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to R3HDM2(R3H domain containing 2) The peptide sequence was selected from the middle region of R3HDM2 (NP_055740). Peptide sequence QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG. |
| Other Names | KIAA1002PR01365, R3H domain containing 2, R3H domain-containing protein 2 |
| Gene, Accession # | R3HDM2, Gene ID: 22864, Accession: Q9Y2K5, SwissProt: Q9Y2K5 |
| Catalog # | NBP1-56775 |
| Price | |
| Order / More Info | R3HDM2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |