| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PARP12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PARP12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PARP12. This antibody reacts with human. The PARP12 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PARP12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CKFGTSCKRSHDFSNSENLEKLEKLGMSSDLVSRLPTIYRNAHDIKNKSSAPSRVPPLFVPQGTSERKDSSGSVSPN |
|---|
| Other Names | EC 2.4.2.30, FLJ22693MST109, PARP-12, poly (ADP-ribose) polymerase family, member 12, poly [ADP-ribose] polymerase 12, ZC3H1, ZC3HDC1MSTP109, Zinc finger CCCH domain-containing protein 1, zinc finger CCCH type domain containing 1, zinc finger CCCH-type domain containing 1 |
|---|
| Gene, Accession # | PARP12, Gene ID: 64761 |
|---|
| Catalog # | NBP2-57018 |
|---|
| Price | |
|---|
| Order / More Info | PARP12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|