| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NET1 |
|---|
| Clone | 3063 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NET1 Antibody (3063) from Novus Biologicals is a mouse monoclonal antibody to NET1. This antibody reacts with human, mouse, rat. The NET1 Antibody (3063) has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NET1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI |
|---|
| Other Names | ARHGEF8neuroepithelial cell-transforming gene 1 protein, guanine nucleotide regulatory protein (oncogene), NET1A, neuroepithelial cell transforming 1, neuroepithelial cell transforming gene 1, neuroepithelioma transforming gene 1, p65 Net1 proto-oncogene protein, Proto-oncogene p65 Net1, Rho guanine nucleotide exchange factor (GEF) 8, Rho guanine nucleotide exchange factor 8, small GTP-binding protein regulator |
|---|
| Gene, Accession # | NET1, Gene ID: 10276, Accession: P23975 |
|---|
| Catalog # | NBP2-46648 |
|---|
| Price | |
|---|
| Order / More Info | NET1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|