| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DTX3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DTX3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DTX3. This antibody reacts with human. The DTX3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DTX3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMC |
|---|
| Other Names | deltex 3 homolog (Drosophila), deltex homolog 3 (Drosophila), deltex3, FLJ34766, MGC138863, MGC138864, protein deltex-3, RING finger protein 154, RNF154deltex 3 homolog |
|---|
| Gene, Accession # | DTX3, Gene ID: 196403, Accession: Q8N9I9, SwissProt: Q8N9I9 |
|---|
| Catalog # | NBP2-31789 |
|---|
| Price | |
|---|
| Order / More Info | DTX3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|