| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAMSN1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAMSN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAMSN1. This antibody reacts with human. The SAMSN1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SAMSN1(SAM domain, SH3 domain and nuclear localization signals 1) The peptide sequence was selected from the middle region of SAMSN1 (NP_071419). Peptide sequence YVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGY. |
|---|
| Other Names | HACS1gene with homology to KIAA0790 protein10NASH1, Hematopoietic adaptor containing SH3 and SAM domains 1, SAM and SH3 domain containing 1, SAM and SH3 domain containing 2, SAM domain, SH3 domain and nuclear localisation signals, 1, SAM domain, SH3 domain and nuclear localization signals 1, SAM domain, SH3 domain and nuclear localization signals protein 1, SAM domain-containing protein SAMSN-1, SH3D6B, SH3-SAM adaptor protein |
|---|
| Gene, Accession # | SAMSN1, Gene ID: 64092, Accession: Q9NSI8, SwissProt: Q9NSI8 |
|---|
| Catalog # | NBP1-52845 |
|---|
| Price | |
|---|
| Order / More Info | SAMSN1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|