| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NALP8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NALP8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NALP8. This antibody reacts with human. The NALP8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NALP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EDLNVGETQVNLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQGVHRHEEYLPCLLLPKRPQGRQPKTVA |
|---|
| Other Names | CLR19.2, NACHT, Leucine Rich Repeat And PYD Containing 8, NACHT, LRR And PYD Containing Protein 8, NACHT, LRR And PYD Domains-Containing Protein 8, NALP-8, NLR Family, Pyrin Domain Containing 8, NLRP8, NOD16, Nucleotide-Binding Oligomerization Domain Protein 16, Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And Pyrin Domain Containing 8, PAN4, PYRIN And NACHT-Containing Protein 4 |
|---|
| Gene, Accession # | NLRP8, Gene ID: 126205, Accession: Q86W28, SwissProt: Q86W28 |
|---|
| Catalog # | NBP2-33809 |
|---|
| Price | |
|---|
| Order / More Info | NALP8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|