| Edit |   |
|---|
| Antigenic Specificity | NaGLT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NaGLT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NaGLT1. This antibody reacts with human. The NaGLT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NaGLT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SGLNEYEEENEEEDAEKWNEMDFEMIETNDTMRHSIIETSRSSLTEPTAEVYNQYPSNALVFESSPFNTGSAHVKHLPETR |
|---|
| Other Names | KIAA1919, MGC33953, NaGLT1, sodium-dependent glucose transporter 1 |
|---|
| Gene, Accession # | KIAA1919, Gene ID: 91749 |
|---|
| Catalog # | NBP1-81104 |
|---|
| Price | |
|---|
| Order / More Info | NaGLT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|