| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NAG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NAG Antibody from Novus Biologicals is a rabbit polyclonal antibody to NAG. This antibody reacts with human. The NAG Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AKGDLKFPLKIFQHSKPDLQQKIIPDQDQLMAIALECIYTCERNDQLCLCYDLLECLPERGYGDKTEATTKLHDMVDQLEQILSVS |
|---|
| Other Names | DKFZp586G1219, EC 1.1.1.94, EC 1.2.1.59, FLJ40407, NAG/BC035112 fusion, NAG/FAM49A fusion, NAGneuroblastoma-amplified protein, neuroblastoma amplified sequence, Neuroblastoma-amplified gene protein, neuroblastoma-amplified sequence |
|---|
| Gene, Accession # | NBAS, Gene ID: 51594 |
|---|
| Catalog # | NBP1-92164-25ul |
|---|
| Price | |
|---|
| Order / More Info | NAG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|