| Edit |   |
|---|
| Antigenic Specificity | NADKD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NADKD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NADKD1. This antibody reacts with human. The NADKD1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NADKD1 The peptide sequence was selected from the middle region of NADKD1. Peptide sequence RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA. |
|---|
| Other Names | chromosome 5 open reading frame 33, FLJ30596, hypothetical protein LOC133686, MGC43298 |
|---|
| Gene, Accession # | NADKD1, Gene ID: 133686, Accession: Q4G0N4, SwissProt: Q4G0N4 |
|---|
| Catalog # | NBP1-56734 |
|---|
| Price | |
|---|
| Order / More Info | NADKD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|