| Edit |   |
| Antigenic Specificity | DC-SCRIPT/ZNF366 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DC-SCRIPT/ZNF366 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DC-SCRIPT/ZNF366. This antibody reacts with human. The DC-SCRIPT/ZNF366 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF366. Peptide sequence LGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLE. |
| Other Names | FLJ39796, zinc finger protein 366 |
| Gene, Accession # | ZNF366, Gene ID: 167465, Accession: NP_689838, SwissProt: NP_689838 |
| Catalog # | NBP1-80414 |
| Price | |
| Order / More Info | DC-SCRIPT/ZNF366 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |