| 产品详情 |
| Edit |   |
| Antigenic Specificity | LSG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LSG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LSG1. This antibody reacts with human, mouse, rat. The LSG1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat LSG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEE |
| Other Names | EC 3.6.1, EC 3.6.1.-, FLJ11301, FLJ27294, hLsg1, large subunit GTPase 1 homolog, large subunit GTPase 1 homolog (S. cerevisiae) |
| Gene, Accession # | LSG1, Gene ID: 55341 |
| Catalog # | NBP1-83755 |
| Price | |
| Order / More Info | LSG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23435261 |
| 产品资料 |
|
|