| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSPEAR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSPEAR Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPEAR. This antibody reacts with human. The TSPEAR Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TSPEAR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST |
|---|
| Other Names | C21orf29, Chromosome 21 Open Reading Frame 29, Deafness, Autosomal Recessive 98, DFNB98, Thrombospondin Type Laminin G Domain And EAR Repeats, Thrombospondin-Type Laminin G Domain And EAR Repeat-Containing Protein, Thrombospondin-Type Laminin G Domain And EAR Repeats-Containing Protein, TSP-EAR |
|---|
| Gene, Accession # | TSPEAR, Gene ID: 54084 |
|---|
| Catalog # | NBP2-55659 |
|---|
| Price | |
|---|
| Order / More Info | TSPEAR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|