| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSPAN8/TM4SF3 |
|---|
| Clone | 1E5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG3 lambda |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSPAN8/TM4SF3 Antibody (1E5) from Novus Biologicals is a mouse monoclonal antibody to TSPAN8/TM4SF3. This antibody reacts with human. The TSPAN8/TM4SF3 Antibody (1E5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | TSPAN8 (NP_004607, 110 a.a. - 205 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN |
|---|
| Other Names | CO-029, tetraspanin 8, TM4SF3tspan-8, Transmembrane 4 superfamily member 3tetraspanin-8, Tspan-8, Tumor-associated antigen CO-029 |
|---|
| Gene, Accession # | TSPAN8, Gene ID: 7103, Accession: NP_004607, SwissProt: NP_004607 |
|---|
| Catalog # | H00007103-M02 |
|---|
| Price | |
|---|
| Order / More Info | TSPAN8/TM4SF3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18365756 |
|---|
| 产品资料 |
|
|