| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSPAN7/TM4SF2 |
|---|
| Clone | CL0265 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSPAN7/TM4SF2 Antibody (CL0265) from Novus Biologicals is a mouse monoclonal antibody to TSPAN7/TM4SF2. This antibody reacts with human. The TSPAN7/TM4SF2 Antibody (CL0265) has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TSPAN7/TM4SF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET |
|---|
| Other Names | A15CCG-B7, CD231, CD231 antigen, Cell surface glycoprotein A15, Membrane component chromosome X surface marker 1, mental retardation, X-linked 58, MRX58, MXS1T-cell acute lymphoblastic leukemia associated antigen 1, T-cell acute lymphoblastic leukemia-associated antigen 1, tetraspanin 7, tetraspanin-7, TM4SF2tetraspanin protein, transmembrane 4 superfamily 2b, Transmembrane 4 superfamily member 2X chromosome, surface marker 1, transmembrane protein A15, Tspan-7 |
|---|
| Gene, Accession # | TSPAN7, Gene ID: 7102 |
|---|
| Catalog # | NBP2-52895 |
|---|
| Price | |
|---|
| Order / More Info | TSPAN7/TM4SF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|