| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSPAN6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSPAN6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPAN6. This antibody reacts with human. The TSPAN6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TSPAN6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEG |
|---|
| Other Names | Putative NF-kappa-B-activating protein 321, T245, T245 protein, tetraspanin 6, Tetraspanin TM4-D, tetraspanin-6, TM4SF6tetraspan TM4SF, Transmembrane 4 superfamily member 6A15 homolog, TSPAN-6 |
|---|
| Gene, Accession # | TSPAN6, Gene ID: 7105 |
|---|
| Catalog # | NBP1-86976 |
|---|
| Price | |
|---|
| Order / More Info | TSPAN6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|