| Edit |   |
|---|
| Antigenic Specificity | TSPAN33 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSPAN33 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPAN33. This antibody reacts with rat. The TSPAN33 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the C terminal of Tspan33. Immunizing peptide sequence NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP. |
|---|
| Other Names | hPen, proerythroblast new membrane, tetraspanin 33, tetraspanin-33, tspan-33 |
|---|
| Gene, Accession # | TSPAN33, Gene ID: 340348, Accession: D3Z967 |
|---|
| Catalog # | NBP1-74070 |
|---|
| Price | |
|---|
| Order / More Info | TSPAN33 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|