| Edit |   |
| Antigenic Specificity | TSPAN33 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TSPAN33 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPAN33. This antibody reacts with rat. The TSPAN33 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the C terminal of Tspan33. Immunizing peptide sequence NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP. |
| Other Names | hPen, proerythroblast new membrane, tetraspanin 33, tetraspanin-33, tspan-33 |
| Gene, Accession # | TSPAN33, Gene ID: 340348, Accession: D3Z967 |
| Catalog # | NBP1-74070-20ul |
| Price | |
| Order / More Info | TSPAN33 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |