| Edit |   |
|---|
| Antigenic Specificity | TSPAN12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSPAN12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPAN12. This antibody reacts with human. The TSPAN12 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human TSPAN12. Peptide sequence: DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI |
|---|
| Other Names | Leukemia-associated protein with a CXXC domain, methylcytosine dioxygenase TET1, NET-2, ten-eleven translocation-1, tetraspanin-12 |
|---|
| Gene, Accession # | TSPAN12, Gene ID: 23554, Accession: NP_036470, SwissProt: NP_036470 |
|---|
| Catalog # | NBP1-91298 |
|---|
| Price | |
|---|
| Order / More Info | TSPAN12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|