| Edit |   |
| Antigenic Specificity | TSPAN12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TSPAN12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPAN12. This antibody reacts with human. The TSPAN12 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human TSPAN12. Peptide sequence: DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI |
| Other Names | Leukemia-associated protein with a CXXC domain, methylcytosine dioxygenase TET1, NET-2, ten-eleven translocation-1, tetraspanin-12 |
| Gene, Accession # | TSPAN12, Gene ID: 23554, Accession: NP_036470, SwissProt: NP_036470 |
| Catalog # | NBP1-91298-20ul |
| Price | |
| Order / More Info | TSPAN12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |