| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Histone H1t2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Histone H1t2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Histone H1t2. This antibody reacts with human. The Histone H1t2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Histone H1t2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKS |
|---|
| Other Names | H1 Histone Family, Member N, Testis-Specific, H1FNT, H1T2, HANP1, Haploid Germ Cell-Specific Nuclear Protein 1, Testis-Specific H1 Histone |
|---|
| Gene, Accession # | H1FNT, Gene ID: 341567, Accession: Q75WM6, SwissProt: Q75WM6 |
|---|
| Catalog # | NBP2-30774 |
|---|
| Price | |
|---|
| Order / More Info | Histone H1t2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|