| 产品详情 |
| Edit |   |
| Antigenic Specificity | TAF5L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TAF5L Antibody from Novus Biologicals is a rabbit polyclonal antibody to TAF5L. This antibody reacts with human. The TAF5L Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human TAF5L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP |
| Other Names | PAF65BPAF65-beta, PCAF associated factor 65 beta, PCAF-associated factor 65 beta, TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 5L, TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD, TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa |
| Gene, Accession # | TAF5L, Gene ID: 27097 |
| Catalog # | NBP2-57546 |
| Price | |
| Order / More Info | TAF5L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|