| 产品详情 |
| Edit |   |
| Antigenic Specificity | PAK3 |
| Clone | 3A12 |
| Host Species | Mouse |
| Reactive Species | human, mouse |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PAK3 Antibody (3A12) from Novus Biologicals is a mouse monoclonal antibody to PAK3. This antibody reacts with human, mouse. The PAK3 Antibody (3A12) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | PAK3 (NP_002569, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGE |
| Other Names | beta-PAK, bPAK, CDKN1A, EC 2.7.11, EC 2.7.11.1, hPAK3, mental retardation, X-linked 47, MRX30, MRX47, Oligophrenin-3, OPHN3, p21 (CDKN1A)-activated kinase 3, p21 protein (Cdc42/Rac)-activated kinase 3, p21-activated kinase 3, PAK-3, PAK3beta, serine/threonine-protein kinase PAK 3 |
| Gene, Accession # | PAK3, Gene ID: 5063, Accession: NP_002569, SwissProt: NP_002569 |
| Catalog # | H00005063-M08 |
| Price | |
| Order / More Info | PAK3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 27071060 |
| 产品资料 |
|
|