| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAK1 |
|---|
| Clone | 4D1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAK1 Antibody (4D1) from Novus Biologicals is a mouse monoclonal antibody to PAK1. This antibody reacts with human. The PAK1 Antibody (4D1) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PAK1 (NP_002567 191 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA |
|---|
| Other Names | alpha-PAK, EC 2.7.11, EC 2.7.11.1, MGC130000, MGC130001, p21 protein (Cdc42/Rac)-activated kinase 1, p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast), p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related), p21-activated kinase 1, p65-PAK, PAK-1, PAKalpha, serine/threonine-protein kinase PAK 1, STE20 homolog, yeast |
|---|
| Gene, Accession # | PAK1, Gene ID: 5058, Accession: NP_002567, SwissProt: NP_002567 |
|---|
| Catalog # | H00005058-M02 |
|---|
| Price | |
|---|
| Order / More Info | PAK1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22022532 |
|---|
| 产品资料 |
|
|