| 产品详情 |
| Edit |   |
| Antigenic Specificity | TAF15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TAF15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TAF15. This antibody reacts with human. The TAF15 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. Specificity of human TAF15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY |
| Other Names | 68kDa, hTAFII68, Npl3, RBP56TAFII68, RNA-binding protein 56, TAF(II)68, TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2NRBP56/CSMF fusion, TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD(RNA-binding protein 56), TATA box-binding protein-associated factor 2N (RNA-binding protein 56), TATA-binding protein-associated factor 2N, TBP-associated factor 15,68 kDa TATA-binding protein-associated factor |
| Gene, Accession # | TAF15, Gene ID: 8148 |
| Catalog # | NBP2-57720 |
| Price | |
| Order / More Info | TAF15 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|