| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TAF13 |
|---|
| Clone | 2B3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TAF13 Antibody (2B3) from Novus Biologicals is a mouse monoclonal antibody to TAF13. This antibody reacts with human. The TAF13 Antibody (2B3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | TAF13 (NP_005636.1, 27 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS |
|---|
| Other Names | 18kDa, MGC22425, TAF(II)18, TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2K, TAFII18TAFII-18, TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD, transcription initiation factor TFIID 18 kD subunit, Transcription initiation factor TFIID 18 kDa subunit, transcription initiation factor TFIID subunit 13 |
|---|
| Gene, Accession # | TAF13, Gene ID: 6884, Accession: NP_005636, SwissProt: NP_005636 |
|---|
| Catalog # | H00006884-M02 |
|---|
| Price | |
|---|
| Order / More Info | TAF13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|