| 产品详情 |
| Edit |   |
| Antigenic Specificity | TAF11 |
| Clone | 3D3 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TAF11 Antibody (3D3) from Novus Biologicals is a mouse monoclonal antibody to TAF11. This antibody reacts with human. The TAF11 Antibody (3D3) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | TAF11 (NP_005634 158 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF |
| Other Names | 28kDa, TAF(II)28, TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2IMGC:15243, TAFII-28, TAFII28TFIID subunit p30-beta, TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD, transcription initiation factor TFIID 28 kD subunit, Transcription initiation factor TFIID 28 kDa subunit, transcription initiation factor TFIID subunit 11 |
| Gene, Accession # | TAF11, Gene ID: 6882, Accession: NP_005634, SwissProt: NP_005634 |
| Catalog # | H00006882-M01 |
| Price | |
| Order / More Info | TAF11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|